PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001451G0450
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GATA
Protein Properties Length: 310aa    MW: 32626.1 Da    PI: 8.4886
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001451G0450genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.71.9e-19230264135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      Cs+Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
  PH01001451G0450 230 CSHCGVQKTPQWRAGPEGAKTLCNACGVRYKSGRL 264
                      *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.965224260IPR000679Zinc finger, GATA-type
SMARTSM004012.1E-18224278IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.03E-15227288No hitNo description
Gene3DG3DSA:3.30.50.101.3E-15228262IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.98E-14229271No hitNo description
PfamPF003201.9E-17230264IPR000679Zinc finger, GATA-type
PROSITE patternPS003440230255IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MAALRSSQRT YEAAEEIAAA AAAGPAAWGA VERGVGLLGE GFSVEELLDL EELCEVDKEV  60
DELCEAAPAA VEEKSSDSRG SSVLSYELMP LPPPVIDLPE VALSAADSMR IPTICALSTE  120
ALVPVKAKRS KRSRASVWSL SGASLSDSTS SSSTTSSCSS SGSFSPFLLL DSPTFVVSDL  180
LDEPPLPKKS KHGKNGKHTP KKRGRKPKHH LPPQLSGGAA SSPVPGDRRC SHCGVQKTPQ  240
WRAGPEGAKT LCNACGVRYK SGRLLPEYRP ACSPTFVNAL HSNSHRKVLE MRRKKEPVIV  300
AAAAAVASF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0916960.0FP091696.1 Phyllostachys edulis cDNA clone: bphylf033o22, full insert sequence.
GenBankFP0935410.0FP093541.1 Phyllostachys edulis cDNA clone: bphylf026a09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953279.11e-102PREDICTED: GATA transcription factor 5-like
TrEMBLA0A0A9FIB01e-108A0A0A9FIB0_ARUDO; Uncharacterized protein
STRINGSi017219m1e-101(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141733108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.23e-41GATA transcription factor 5